PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G04780.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 385aa    MW: 40907.2 Da    PI: 7.4039
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G04780.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.71.3e-3346100155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  OPUNC02G04780.1  46 KPRLRWTVELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 100
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.34743103IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.7E-3243101IPR009057Homeodomain-like
SuperFamilySSF466891.79E-1645101IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-2346101IPR006447Myb domain, plants
PfamPF002491.2E-74898IPR001005SANT/Myb domain
PfamPF143794.3E-25141187IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010088Biological Processphloem development
GO:0010089Biological Processxylem development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MFPGSKKGGG GGGAAVSSGD GGRAAAAAAA MCVQGDSGLV LTTDPKPRLR WTVELHERFV  60
DAVTQLGGPD KATPKTIMRV MGVKGLTLYH LKSHLQKFRL GKQPHKEFSE HSVKEAAAME  120
MQRNAASSSG IMGRSMNHDR NVNDAIRMQM EVQRRLHEQL EVQKHLQMRI EAQGKYMQSI  180
LEKAYQTLAA GDVAAAATCG PAGYKSLGNQ AVLDVCSMGF PSLQEFHMYG GGGGHLDLQQ  240
QQQLDQRPPA TMESFFACSV DGSSLGKTAA KRHSHYGGGA GKSPMMWGGD DVDVDDDDDD  300
PVGKCGHQLQ MAPPPMMDGG GIDVMDSIAA DVYEPKPIMS GDSTGSKGGG YDAAASKLER  360
QSPRRPQQLG SPSVMGAQTR NLSYG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0057720.0AP005772.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0073A21.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624013.10.0PREDICTED: myb family transcription factor APL isoform X1
SwissprotQ9SAK56e-96APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0E0JW670.0A0A0E0JW67_ORYPU; Uncharacterized protein
STRINGLOC_Os02g07770.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25043890
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-88G2-like family protein